SCOP 1.75: Domain d2dtyb1: 2dty B:1-237

Lineage for d2dtyb1 (2dty B:1-237)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (14 PDB entries)

8. Domain d2dtyb1: 2dty B:1-237 [131738]
   automatically matched to d1wbfa_
   complexed with a2g, bma, ca, fuc, ful, mn, nag

Details for d2dtyb1

PDB Entry: 2dty, 2.65 Å

PDB Description: crystal structure of basic winged bean lectin complexed with n-acetyl- d-galactosamine

PDB Compounds: (B:) Basic agglutinin

SCOP Domain Sequences for d2dtyb1:

Sequence; same for both SEQRES and ATOM records:

>d2dtyb1 b.29.1.1 (B:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

Timeline for d2dtyb1:

• d2dtyb1 first appeared in SCOP 1.73
  
• d2dtyb1 is called d2dtyb_ in SCOPe 2.01
  
• d2dtyb1 appears in the current release, SCOPe 2.08, called d2dtyb_