SCOPe 2.07: Domain d2dtwb_: 2dtw B:

Lineage for d2dtwb_ (2dtw B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries)

8. Domain d2dtwb_: 2dtw B: [131734]
   automated match to d1wbfa_
   complexed with 2gs, bma, ca, fuc, ful, mn, nag, ndg

Details for d2dtwb_

PDB Entry: 2dtw, 2.4 Å

PDB Description: crystal structure of basic winged bean lectin in complex with 2me-o-d- galactose

PDB Compounds: (B:) Basic agglutinin

SCOPe Domain Sequences for d2dtwb_:

Sequence; same for both SEQRES and ATOM records:

>d2dtwb_ b.29.1.1 (B:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

Timeline for d2dtwb_:

• d2dtwb_ first appeared in SCOP 1.73, called d2dtwb1
  
• d2dtwb_ appears in SCOPe 2.06
  
• d2dtwb_ appears in the current release, SCOPe 2.08