Lineage for d2dtwa_ (2dtw A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2387950Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2388157Protein Legume lectin [49904] (23 species)
  7. 2388494Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries)
  8. 2388533Domain d2dtwa_: 2dtw A: [131733]
    automated match to d1wbfa_
    complexed with 2gs, bma, ca, fuc, ful, mn, nag, ndg

Details for d2dtwa_

PDB Entry: 2dtw (more details), 2.4 Å

PDB Description: crystal structure of basic winged bean lectin in complex with 2me-o-d- galactose
PDB Compounds: (A:) Basic agglutinin

SCOPe Domain Sequences for d2dtwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtwa_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOPe Domain Coordinates for d2dtwa_:

Click to download the PDB-style file with coordinates for d2dtwa_.
(The format of our PDB-style files is described here.)

Timeline for d2dtwa_: