Lineage for d2dtsa2 (2dts A:342-444)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1761558Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 1761561Species Human (Homo sapiens) [TaxId:9606] [88590] (49 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 1761567Domain d2dtsa2: 2dts A:342-444 [131730]
    Other proteins in same PDB: d2dtsa1, d2dtsb1
    automated match to d1igyb4
    complexed with nag

Details for d2dtsa2

PDB Entry: 2dts (more details), 2.2 Å

PDB Description: crystal structure of the defucosylated fc fragment from human immunoglobulin g1
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d2dtsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtsa2 b.1.1.2 (A:342-444) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

SCOPe Domain Coordinates for d2dtsa2:

Click to download the PDB-style file with coordinates for d2dtsa2.
(The format of our PDB-style files is described here.)

Timeline for d2dtsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dtsa1