Lineage for d2dtsa1 (2dts A:234-341)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [88585] (61 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. Domain d2dtsa1: 2dts A:234-341 [131729]
    Other proteins in same PDB: d2dtsa2, d2dtsb2
    automated match to d1igyb3

Details for d2dtsa1

PDB Entry: 2dts (more details), 2.2 Å

PDB Description: crystal structure of the defucosylated fc fragment from human immunoglobulin g1
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d2dtsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtsa1 b.1.1.2 (A:234-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
llggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpre
eqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

SCOPe Domain Coordinates for d2dtsa1 are not available.

Timeline for d2dtsa1:

Domains from same chain:
(mouse over for more information)
d2dtsa2
Domains from other chains:
(mouse over for more information)
d2dtsb1, d2dtsb2