Lineage for d2dtsa1 (2dts A:234-341)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2351136Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 2351137Species Human (Homo sapiens) [TaxId:9606] [88585] (58 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2351148Domain d2dtsa1: 2dts A:234-341 [131729]
    Other proteins in same PDB: d2dtsa2, d2dtsb2
    automated match to d1igyb3
    complexed with nag

Details for d2dtsa1

PDB Entry: 2dts (more details), 2.2 Å

PDB Description: Crystal Structure of the Defucosylated Fc Fragment from Human Immunoglobulin G1
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d2dtsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtsa1 b.1.1.2 (A:234-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
llggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpre
eqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

SCOPe Domain Coordinates for d2dtsa1:

Click to download the PDB-style file with coordinates for d2dtsa1.
(The format of our PDB-style files is described here.)

Timeline for d2dtsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dtsa2