Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins) |
Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species) |
Species Pyrococcus horikoshii [TaxId:53953] [143641] (26 PDB entries) Uniprot O57883 1-188 |
Domain d2dtoa2: 2dto A:1-188 [131722] Other proteins in same PDB: d2dtoa1, d2dtob1 automated match to d1wnla2 complexed with atp, btn |
PDB Entry: 2dto (more details), 1.5 Å
SCOPe Domain Sequences for d2dtoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dtoa2 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]} mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln lvrdnmil
Timeline for d2dtoa2: