SCOP 1.75: Domain d2dthb2: 2dth B:1-188

Lineage for d2dthb2 (2dth B:1-188)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families)

5. Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins)

6. Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143641] (14 PDB entries)
   Uniprot O57883 1-188

8. Domain d2dthb2: 2dth B:1-188 [131716]
   Other proteins in same PDB: d2dtha1, d2dthb1
   automatically matched to 1WNL A:1-188
   complexed with adp, btn

Details for d2dthb2

PDB Entry: 2dth, 1.95 Å

PDB Description: The Crystal Structure of the Orthorhombic Form of Biotin Protein Ligase From Pyrococcus Horikoshii OT3 in Complex with Biotin and ADP

PDB Compounds: (B:) 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] ligase

SCOP Domain Sequences for d2dthb2:

Sequence; same for both SEQRES and ATOM records:

>d2dthb2 d.104.1.2 (B:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

Timeline for d2dthb2:

• d2dthb2 first appeared in SCOP 1.73
  
• d2dthb2 appears in SCOPe 2.01
  
• d2dthb2 appears in the current release, SCOPe 2.08