Lineage for d2dthb2 (2dth B:1-188)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730671Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 730672Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (3 families) (S)
  5. 730883Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins)
  6. 730892Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)
  7. 730893Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143641] (10 PDB entries)
  8. 730911Domain d2dthb2: 2dth B:1-188 [131716]
    Other proteins in same PDB: d2dtha1, d2dthb1
    automatically matched to 1WNL A:1-188
    complexed with adp, btn

Details for d2dthb2

PDB Entry: 2dth (more details), 1.95 Å

PDB Description: The Crystal Structure of the Orthorhombic Form of Biotin Protein Ligase From Pyrococcus Horikoshii OT3 in Complex with Biotin and ADP
PDB Compounds: (B:) 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] ligase

SCOP Domain Sequences for d2dthb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dthb2 d.104.1.2 (B:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

SCOP Domain Coordinates for d2dthb2:

Click to download the PDB-style file with coordinates for d2dthb2.
(The format of our PDB-style files is described here.)

Timeline for d2dthb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dthb1