![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (3 families) ![]() |
![]() | Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins) |
![]() | Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species) |
![]() | Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143641] (10 PDB entries) |
![]() | Domain d2dtha2: 2dth A:1-188 [131714] Other proteins in same PDB: d2dtha1, d2dthb1 automatically matched to 1WNL A:1-188 complexed with adp, btn |
PDB Entry: 2dth (more details), 1.95 Å
SCOP Domain Sequences for d2dtha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dtha2 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln lvrdnmil
Timeline for d2dtha2: