SCOP 1.75: Domain d2dt5b2: 2dt5 B:78-203

Lineage for d2dt5b2 (2dt5 B:78-203)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.12: Transcriptional repressor Rex, C-terminal domain [102174] (1 protein)

6. Protein Transcriptional repressor Rex, C-terminal domain [102175] (1 species)
   forms swapped dimer with C-terminal helices

7. Species Thermus aquaticus [TaxId:271] [102176] (2 PDB entries)
   Uniprot Q9X2V5
   CASP5

8. Domain d2dt5b2: 2dt5 B:78-203 [131711]
   Other proteins in same PDB: d2dt5a1, d2dt5b1
   automatically matched to d1xcba2
   complexed with cl, gol, nad, so4; mutant

Details for d2dt5b2

PDB Entry: 2dt5, 2.16 Å

PDB Description: crystal structure of ttha1657 (at-rich dna-binding protein) from thermus thermophilus hb8

PDB Compounds: (B:) AT-rich DNA-binding protein

SCOP Domain Sequences for d2dt5b2:

Sequence; same for both SEQRES and ATOM records:

>d2dt5b2 c.2.1.12 (B:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]}
nrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggviehvdllpqrv
pgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdflagltrls
failnp

Timeline for d2dt5b2:

• d2dt5b2 first appeared in SCOP 1.73
  
• d2dt5b2 appears in SCOPe 2.01
  
• d2dt5b2 appears in the current release, SCOPe 2.08