Lineage for d2dt5b2 (2dt5 B:78-203)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 688669Family c.2.1.12: Transcriptional repressor Rex, C-terminal domain [102174] (1 protein)
  6. 688670Protein Transcriptional repressor Rex, C-terminal domain [102175] (1 species)
    forms swapped dimer with C-terminal helices
  7. 688671Species Thermus aquaticus [TaxId:271] [102176] (2 PDB entries)
    CASP5
  8. 688673Domain d2dt5b2: 2dt5 B:78-203 [131711]
    Other proteins in same PDB: d2dt5a1, d2dt5b1
    automatically matched to d1xcba2
    complexed with cl, gol, nad, so4; mutant

Details for d2dt5b2

PDB Entry: 2dt5 (more details), 2.16 Å

PDB Description: crystal structure of ttha1657 (at-rich dna-binding protein) from thermus thermophilus hb8
PDB Compounds: (B:) AT-rich DNA-binding protein

SCOP Domain Sequences for d2dt5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dt5b2 c.2.1.12 (B:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]}
nrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggviehvdllpqrv
pgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdflagltrls
failnp

SCOP Domain Coordinates for d2dt5b2:

Click to download the PDB-style file with coordinates for d2dt5b2.
(The format of our PDB-style files is described here.)

Timeline for d2dt5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dt5b1