Lineage for d2dt5b1 (2dt5 B:1-77)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307453Family a.4.5.38: Transcriptional repressor Rex, N-terminal domain [101007] (1 protein)
  6. 2307454Protein Transcriptional repressor Rex, N-terminal domain [101008] (1 species)
    AT-rich DNA-binding protein p25
  7. 2307455Species Thermus aquaticus [TaxId:271] [101009] (3 PDB entries)
    Uniprot Q9X2V5; # CASP5
  8. 2307457Domain d2dt5b1: 2dt5 B:1-77 [131710]
    Other proteins in same PDB: d2dt5a2, d2dt5b2
    automated match to d1r72f3
    complexed with cl, gol, nad, so4

Details for d2dt5b1

PDB Entry: 2dt5 (more details), 2.16 Å

PDB Description: crystal structure of ttha1657 (at-rich dna-binding protein) from thermus thermophilus hb8
PDB Compounds: (B:) AT-rich DNA-binding protein

SCOPe Domain Sequences for d2dt5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dt5b1 a.4.5.38 (B:1-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]}
mkvpeaaisrlitylrileeleaqgvhrtsseqlgglaqvtafqvrkdlsyfgsygtrgv
gytvpvlkrelrhilgl

SCOPe Domain Coordinates for d2dt5b1:

Click to download the PDB-style file with coordinates for d2dt5b1.
(The format of our PDB-style files is described here.)

Timeline for d2dt5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dt5b2