Lineage for d2dt5b1 (2dt5 B:4-77)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635662Family a.4.5.38: Transcriptional repressor Rex, N-terminal domain [101007] (1 protein)
  6. 635663Protein Transcriptional repressor Rex, N-terminal domain [101008] (1 species)
    AT-rich DNA-binding protein p25
  7. 635664Species Thermus aquaticus [TaxId:271] [101009] (2 PDB entries)
  8. 635666Domain d2dt5b1: 2dt5 B:4-77 [131710]
    Other proteins in same PDB: d2dt5a2, d2dt5b2
    automatically matched to d1xcba1
    complexed with cl, gol, nad, so4; mutant

Details for d2dt5b1

PDB Entry: 2dt5 (more details), 2.16 Å

PDB Description: Crystal Structure of TTHA1657 (AT-rich DNA-binding protein) from Thermus thermophilus HB8
PDB Compounds: (B:) AT-rich DNA-binding protein

SCOP Domain Sequences for d2dt5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dt5b1 a.4.5.38 (B:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]}
peaaisrlitylrileeleaqgvhrtsseqlgglaqvtafqvrkdlsyfgsygtrgvgyt
vpvlkrelrhilgl

SCOP Domain Coordinates for d2dt5b1:

Click to download the PDB-style file with coordinates for d2dt5b1.
(The format of our PDB-style files is described here.)

Timeline for d2dt5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dt5b2