SCOP 1.73: Domain d2dt5a1: 2dt5 A:4-77

Lineage for d2dt5a1 (2dt5 A:4-77)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.38: Transcriptional repressor Rex, N-terminal domain [101007] (1 protein)

6. Protein Transcriptional repressor Rex, N-terminal domain [101008] (1 species)
   AT-rich DNA-binding protein p25

7. Species Thermus aquaticus [TaxId:271] [101009] (2 PDB entries)

8. Domain d2dt5a1: 2dt5 A:4-77 [131708]
   Other proteins in same PDB: d2dt5a2, d2dt5b2
   automatically matched to d1xcba1
   complexed with cl, gol, nad, so4; mutant

Details for d2dt5a1

PDB Entry: 2dt5, 2.16 Å

PDB Description: crystal structure of ttha1657 (at-rich dna-binding protein) from thermus thermophilus hb8

PDB Compounds: (A:) AT-rich DNA-binding protein

SCOP Domain Sequences for d2dt5a1:

Sequence; same for both SEQRES and ATOM records:

>d2dt5a1 a.4.5.38 (A:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]}
peaaisrlitylrileeleaqgvhrtsseqlgglaqvtafqvrkdlsyfgsygtrgvgyt
vpvlkrelrhilgl

Timeline for d2dt5a1:

• d2dt5a1 is new in SCOP 1.73
  
• d2dt5a1 appears in SCOP 1.75
  
• d2dt5a1 appears in the current release, SCOPe 2.08