Lineage for d2dt0a2 (2dt0 A:240-307)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857507Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 857703Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 857704Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 857844Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 857851Species Goat (Capra hircus) [TaxId:9925] [89883] (14 PDB entries)
  8. 857855Domain d2dt0a2: 2dt0 A:240-307 [131701]
    Other proteins in same PDB: d2dt0a1
    automatically matched to d1ljya2
    complexed with bma, nag, ndg

Details for d2dt0a2

PDB Entry: 2dt0 (more details), 2.45 Å

PDB Description: crystal structure of the complex of goat signalling protein with the trimer of n-acetylglucosamine at 2.45a resolution
PDB Compounds: (A:) Chitinase-3-like protein 1

SCOP Domain Sequences for d2dt0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dt0a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus) [TaxId: 9925]}
fgrsftlassktdvgapisgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

SCOP Domain Coordinates for d2dt0a2:

Click to download the PDB-style file with coordinates for d2dt0a2.
(The format of our PDB-style files is described here.)

Timeline for d2dt0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dt0a1