Lineage for d2dsxa_ (2dsx A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464186Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1464187Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1464196Protein Rubredoxin [57804] (8 species)
  7. 1464230Species Desulfovibrio gigas [TaxId:879] [57806] (3 PDB entries)
  8. 1464231Domain d2dsxa_: 2dsx A: [131699]
    automated match to d1e8ja_
    complexed with fe

Details for d2dsxa_

PDB Entry: 2dsx (more details), 0.68 Å

PDB Description: Crystal structure of rubredoxin from Desulfovibrio gigas to ultra-high 0.68 A resolution
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d2dsxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dsxa_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio gigas [TaxId: 879]}
mdiyvctvcgyeydpakgdpdsgikpgtkfedlpddwacpvcgaskdafekq

SCOPe Domain Coordinates for d2dsxa_:

Click to download the PDB-style file with coordinates for d2dsxa_.
(The format of our PDB-style files is described here.)

Timeline for d2dsxa_: