Lineage for d2dsxa1 (2dsx A:1-52)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 750855Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 750856Family g.41.5.1: Rubredoxin [57803] (4 proteins)
  6. 750865Protein Rubredoxin [57804] (6 species)
  7. 750911Species Desulfovibrio gigas [TaxId:879] [57806] (3 PDB entries)
  8. 750912Domain d2dsxa1: 2dsx A:1-52 [131699]
    automatically matched to d1e8ja_
    complexed with fe

Details for d2dsxa1

PDB Entry: 2dsx (more details), 0.68 Å

PDB Description: Crystal structure of rubredoxin from Desulfovibrio gigas to ultra-high 0.68 A resolution
PDB Compounds: (A:) rubredoxin

SCOP Domain Sequences for d2dsxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]}
mdiyvctvcgyeydpakgdpdsgikpgtkfedlpddwacpvcgaskdafekq

SCOP Domain Coordinates for d2dsxa1:

Click to download the PDB-style file with coordinates for d2dsxa1.
(The format of our PDB-style files is described here.)

Timeline for d2dsxa1: