Lineage for d2dsri_ (2dsr I:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634416Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2634417Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2634418Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2634641Protein Insulin-like growth factor [57002] (1 species)
  7. 2634642Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
    Uniprot P05019 49-110
  8. 2634646Domain d2dsri_: 2dsr I: [131698]
    Other proteins in same PDB: d2dsrb_, d2dsrg1
    automated match to d1bqt__

Details for d2dsri_

PDB Entry: 2dsr (more details), 2.1 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins
PDB Compounds: (I:) Insulin-like growth factor IB

SCOPe Domain Sequences for d2dsri_:

Sequence, based on SEQRES records: (download)

>d2dsri_ g.1.1.1 (I:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyc
apl

Sequence, based on observed residues (ATOM records): (download)

>d2dsri_ g.1.1.1 (I:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptgygssapqtgivdeccfrscdlrrlemycapl

SCOPe Domain Coordinates for d2dsri_:

Click to download the PDB-style file with coordinates for d2dsri_.
(The format of our PDB-style files is described here.)

Timeline for d2dsri_: