SCOP 1.75: Domain d2dsqi1: 2dsq I:2-64

Lineage for d2dsqi1 (2dsq I:2-64)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)
   nearly all-alpha
   can be classified as disulfide-rich

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (4 proteins)

6. Protein Insulin-like growth factor [57002] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57003] (19 PDB entries)
   Uniprot P05019 49-110

8. Domain d2dsqi1: 2dsq I:2-64 [131697]
   Other proteins in same PDB: d2dsqa1, d2dsqb1, d2dsqg1, d2dsqh1
   automatically matched to d1bqt__

Details for d2dsqi1

PDB Entry: 2dsq, 2.8 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins

PDB Compounds: (I:) Insulin-like growth factor IB

SCOP Domain Sequences for d2dsqi1:

Sequence, based on SEQRES records:

>d2dsqi1 g.1.1.1 (I:2-64) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyc
apl

Sequence, based on observed residues (ATOM records):

>d2dsqi1 g.1.1.1 (I:2-64) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkgivdeccfrscdlrrlemycapl

Timeline for d2dsqi1:

• d2dsqi1 first appeared in SCOP 1.73
  
• d2dsqi1 is called d2dsqi_ in SCOPe 2.01
  
• d2dsqi1 appears in the current release, SCOPe 2.08, called d2dsqi_