Class g: Small proteins [56992] (85 folds) |
Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
Superfamily g.1.1: Insulin-like [56994] (1 family) |
Family g.1.1.1: Insulin-like [56995] (4 proteins) |
Protein Insulin-like growth factor [57002] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57003] (18 PDB entries) |
Domain d2dsqi1: 2dsq I:2-64 [131697] automatically matched to d1bqt__ |
PDB Entry: 2dsq (more details), 2.8 Å
SCOP Domain Sequences for d2dsqi1:
Sequence, based on SEQRES records: (download)
>d2dsqi1 g.1.1.1 (I:2-64) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]} petlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyc apl
>d2dsqi1 g.1.1.1 (I:2-64) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]} petlcgaelvdalqfvcgdrgfyfnkgivdeccfrscdlrrlemycapl
Timeline for d2dsqi1: