Lineage for d2dsqi1 (2dsq I:2-64)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 746752Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 746753Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 746754Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 746974Protein Insulin-like growth factor [57002] (1 species)
  7. 746975Species Human (Homo sapiens) [TaxId:9606] [57003] (18 PDB entries)
  8. 746986Domain d2dsqi1: 2dsq I:2-64 [131697]
    automatically matched to d1bqt__

Details for d2dsqi1

PDB Entry: 2dsq (more details), 2.8 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins
PDB Compounds: (I:) Insulin-like growth factor IB

SCOP Domain Sequences for d2dsqi1:

Sequence, based on SEQRES records: (download)

>d2dsqi1 g.1.1.1 (I:2-64) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyc
apl

Sequence, based on observed residues (ATOM records): (download)

>d2dsqi1 g.1.1.1 (I:2-64) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkgivdeccfrscdlrrlemycapl

SCOP Domain Coordinates for d2dsqi1:

Click to download the PDB-style file with coordinates for d2dsqi1.
(The format of our PDB-style files is described here.)

Timeline for d2dsqi1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dsqc1