Lineage for d2dsqi_ (2dsq I:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581249Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2581250Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2581251Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2581473Protein Insulin-like growth factor [57002] (1 species)
  7. 2581474Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
    Uniprot P05019 49-110
  8. 2581485Domain d2dsqi_: 2dsq I: [131697]
    Other proteins in same PDB: d2dsqa_, d2dsqb_, d2dsqg1, d2dsqh_
    automated match to d1bqt__

Details for d2dsqi_

PDB Entry: 2dsq (more details), 2.8 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins
PDB Compounds: (I:) Insulin-like growth factor IB

SCOPe Domain Sequences for d2dsqi_:

Sequence, based on SEQRES records: (download)

>d2dsqi_ g.1.1.1 (I:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyc
apl

Sequence, based on observed residues (ATOM records): (download)

>d2dsqi_ g.1.1.1 (I:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkgivdeccfrscdlrrlemycapl

SCOPe Domain Coordinates for d2dsqi_:

Click to download the PDB-style file with coordinates for d2dsqi_.
(The format of our PDB-style files is described here.)

Timeline for d2dsqi_: