SCOP 1.73: Domain d2dsqc1: 2dsq C:2-63

Lineage for d2dsqc1 (2dsq C:2-63)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)
   nearly all-alpha
   can be classified as disulfide-rich

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (4 proteins)

6. Protein Insulin-like growth factor [57002] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57003] (18 PDB entries)

8. Domain d2dsqc1: 2dsq C:2-63 [131696]
   automatically matched to d1bqt__

Details for d2dsqc1

PDB Entry: 2dsq, 2.8 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins

PDB Compounds: (C:) Insulin-like growth factor IB

SCOP Domain Sequences for d2dsqc1:

Sequence, based on SEQRES records:

>d2dsqc1 g.1.1.1 (C:2-63) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyc
ap

Sequence, based on observed residues (ATOM records):

>d2dsqc1 g.1.1.1 (C:2-63) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkpttgivdeccfrscdlrrlemycap

Timeline for d2dsqc1:

• d2dsqc1 is new in SCOP 1.73
  
• d2dsqc1 appears in SCOP 1.75
  
• d2dsqc1 appears in the current release, SCOPe 2.08, called d2dsqc_