SCOPe 2.08: Domain d2dsqc_: 2dsq C:

Lineage for d2dsqc_ (2dsq C:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)
   nearly all-alpha
   can be classified as disulfide-rich

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (5 proteins)

6. Protein Insulin-like growth factor [57002] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
   Uniprot P05019 49-110

8. Domain d2dsqc_: 2dsq C: [131696]
   Other proteins in same PDB: d2dsqa_, d2dsqb_, d2dsqg1, d2dsqh_
   automated match to d1bqt__

Details for d2dsqc_

PDB Entry: 2dsq, 2.8 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins

PDB Compounds: (C:) Insulin-like growth factor IB

SCOPe Domain Sequences for d2dsqc_:

Sequence, based on SEQRES records:

>d2dsqc_ g.1.1.1 (C:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyc
ap

Sequence, based on observed residues (ATOM records):

>d2dsqc_ g.1.1.1 (C:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkpttgivdeccfrscdlrrlemycap

Timeline for d2dsqc_:

• d2dsqc_ first appeared in SCOP 1.73, called d2dsqc1
  
• d2dsqc_ appears in SCOPe 2.07