Lineage for d2dspi1 (2dsp I:2-68)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888633Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 888634Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 888635Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 888855Protein Insulin-like growth factor [57002] (1 species)
  7. 888856Species Human (Homo sapiens) [TaxId:9606] [57003] (19 PDB entries)
    Uniprot P05019 49-110
  8. 888863Domain d2dspi1: 2dsp I:2-68 [131695]
    Other proteins in same PDB: d2dspb1
    automatically matched to d1bqt__

Details for d2dspi1

PDB Entry: 2dsp (more details), 2.5 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins
PDB Compounds: (I:) Insulin-like growth factor IB

SCOP Domain Sequences for d2dspi1:

Sequence, based on SEQRES records: (download)

>d2dspi1 g.1.1.1 (I:2-68) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyc
aplkpak

Sequence, based on observed residues (ATOM records): (download)

>d2dspi1 g.1.1.1 (I:2-68) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptqtgivdeccfrscdlrrlemycaplkpak

SCOP Domain Coordinates for d2dspi1:

Click to download the PDB-style file with coordinates for d2dspi1.
(The format of our PDB-style files is described here.)

Timeline for d2dspi1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dspb1