![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
![]() | Superfamily g.1.1: Insulin-like [56994] (1 family) ![]() |
![]() | Family g.1.1.1: Insulin-like [56995] (4 proteins) |
![]() | Protein Insulin-like growth factor [57002] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57003] (18 PDB entries) |
![]() | Domain d2dspi1: 2dsp I:2-68 [131695] automatically matched to d1bqt__ |
PDB Entry: 2dsp (more details), 2.5 Å
SCOP Domain Sequences for d2dspi1:
Sequence, based on SEQRES records: (download)
>d2dspi1 g.1.1.1 (I:2-68) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]} petlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyc aplkpak
>d2dspi1 g.1.1.1 (I:2-68) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]} petlcgaelvdalqfvcgdrgfyfnkptqtgivdeccfrscdlrrlemycaplkpak
Timeline for d2dspi1: