Class g: Small proteins [56992] (100 folds) |
Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
Superfamily g.1.1: Insulin-like [56994] (1 family) |
Family g.1.1.1: Insulin-like [56995] (5 proteins) |
Protein Insulin-like growth factor [57002] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries) Uniprot P05019 49-110 |
Domain d2dspi_: 2dsp I: [131695] Other proteins in same PDB: d2dspb1 automated match to d1bqt__ |
PDB Entry: 2dsp (more details), 2.5 Å
SCOPe Domain Sequences for d2dspi_:
Sequence, based on SEQRES records: (download)
>d2dspi_ g.1.1.1 (I:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]} petlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyc aplkpak
>d2dspi_ g.1.1.1 (I:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]} petlcgaelvdalqfvcgdrgfyfnkptqtgivdeccfrscdlrrlemycaplkpak
Timeline for d2dspi_: