Lineage for d2dspi_ (2dsp I:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029609Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 3029610Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 3029611Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 3029834Protein Insulin-like growth factor [57002] (1 species)
  7. 3029835Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
    Uniprot P05019 49-110
  8. 3029841Domain d2dspi_: 2dsp I: [131695]
    Other proteins in same PDB: d2dspb1
    automated match to d1bqt__

Details for d2dspi_

PDB Entry: 2dsp (more details), 2.5 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins
PDB Compounds: (I:) Insulin-like growth factor IB

SCOPe Domain Sequences for d2dspi_:

Sequence, based on SEQRES records: (download)

>d2dspi_ g.1.1.1 (I:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyc
aplkpak

Sequence, based on observed residues (ATOM records): (download)

>d2dspi_ g.1.1.1 (I:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptqtgivdeccfrscdlrrlemycaplkpak

SCOPe Domain Coordinates for d2dspi_:

Click to download the PDB-style file with coordinates for d2dspi_.
(The format of our PDB-style files is described here.)

Timeline for d2dspi_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dspb1