SCOP 1.73: Domain d2dsob1: 2dso B:7-324

Lineage for d2dsob1 (2dso B:7-324)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (2 families)

5. Family b.68.6.1: SGL-like [63830] (3 proteins)

6. Protein Lactonase Drp35 [141546] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [141547] (3 PDB entries)

8. Domain d2dsob1: 2dso B:7-324 [131690]
   automatically matched to 2DSO A:5-324
   complexed with ca, gol; mutant

Details for d2dsob1

PDB Entry: 2dso, 2.1 Å

PDB Description: crystal structure of d138n mutant of drp35, a 35kda drug responsive protein from staphylococcus aureus

PDB Compounds: (B:) DrP35

SCOP Domain Sequences for d2dsob1:

Sequence; same for both SEQRES and ATOM records:

>d2dsob1 b.68.6.1 (B:7-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}
dlptlfysgksnsavpiiseselqtitaepwleiskkglqleglnfdrqgqlflldvfeg
nifkinpetkeikrpfvshkanpaaikihkdgrlfvcylgdfkstggifaatengdnlqd
iiedlstaycindmvfdskggfyftdfrgystnplggvyyvspdfrtvtpiiqnisvang
ialstdekvlwvtettanrlhrialeddgvtiqpfgatipyyftghegpdsccidsddnl
yvamygqgrvlvfnkrgypigqilipgrdeghmlrsthpqfipgtnqliicsndiemggg
smlytvngfakghqsfqf

Timeline for d2dsob1:

• d2dsob1 is new in SCOP 1.73
  
• d2dsob1 appears in SCOP 1.75
  
• d2dsob1 appears in the current release, SCOPe 2.08, called d2dsob2