Lineage for d2dsfa1 (2dsf A:342-685)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 711143Family c.94.1.2: Transferrin [53888] (3 protein domains)
    further duplication: composed of two two-domain lobes
  6. 711144Protein Lactoferrin [53889] (6 species)
  7. 711150Species Cow (Bos taurus) [TaxId:9913] [53891] (36 PDB entries)
  8. 711185Domain d2dsfa1: 2dsf A:342-685 [131688]
    automatically matched to d1nkxa_
    complexed with bma, co3, fe, lxc, man, nag, ndg, so4, zn

Details for d2dsfa1

PDB Entry: 2dsf (more details), 2.8 Å

PDB Description: Structure of the complex of C-terminal lobe of bovine lactoferrin with xylose at 2.8A resolution
PDB Compounds: (A:) lactotransferrin

SCOP Domain Sequences for d2dsfa1:

Sequence, based on SEQRES records: (download)

>d2dsfa1 c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcstsplleaca

Sequence, based on observed residues (ATOM records): (download)

>d2dsfa1 c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcsleaca

SCOP Domain Coordinates for d2dsfa1:

Click to download the PDB-style file with coordinates for d2dsfa1.
(The format of our PDB-style files is described here.)

Timeline for d2dsfa1: