Lineage for d2ds9a1 (2ds9 A:342-685)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1009393Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 1009394Protein Lactoferrin [53889] (6 species)
  7. 1009400Species Cow (Bos taurus) [TaxId:9913] [53891] (44 PDB entries)
  8. 1009443Domain d2ds9a1: 2ds9 A:342-685 [131687]
    automatically matched to d1nkxa_
    complexed with co3, fe, man, nag, so4, zn

Details for d2ds9a1

PDB Entry: 2ds9 (more details), 2.8 Å

PDB Description: structure of the complex of c-terminal lobe of bovine lactoferrin with mannose at 2.8 a resolution
PDB Compounds: (A:) lactotransferrin

SCOPe Domain Sequences for d2ds9a1:

Sequence, based on SEQRES records: (download)

>d2ds9a1 c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcstsplleaca

Sequence, based on observed residues (ATOM records): (download)

>d2ds9a1 c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcsleaca

SCOPe Domain Coordinates for d2ds9a1:

Click to download the PDB-style file with coordinates for d2ds9a1.
(The format of our PDB-style files is described here.)

Timeline for d2ds9a1: