SCOP 1.73: Domain d2ds6a1: 2ds6 A:11-48

Lineage for d2ds6a1 (2ds6 A:11-48)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families)

5. Family g.39.1.11: ClpX chaperone zinc binding domain [103608] (1 protein)

6. Protein ClpX chaperone zinc binding domain [103609] (1 species)

7. Species Escherichia coli [TaxId:562] [103610] (4 PDB entries)

8. Domain d2ds6a1: 2ds6 A:11-48 [131683]
   automatically matched to d1ovxa_
   complexed with zn

Details for d2ds6a1

PDB Entry: 2ds6, 2 Å

PDB Description: Structure of the ZBD in the tetragonal crystal form

PDB Compounds: (A:) ATP-dependent Clp protease ATP-binding subunit clpX

SCOP Domain Sequences for d2ds6a1:

Sequence; same for both SEQRES and ATOM records:

>d2ds6a1 g.39.1.11 (A:11-48) ClpX chaperone zinc binding domain {Escherichia coli [TaxId: 562]}
llycsfcgksqhevrkliagpsvyicdecvdlcndiir

Timeline for d2ds6a1:

• d2ds6a1 is new in SCOP 1.73
  
• d2ds6a1 appears in SCOP 1.75
  
• d2ds6a1 appears in the current release, SCOPe 2.08, called d2ds6a_