Lineage for d2ds5b_ (2ds5 B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3036057Family g.39.1.11: ClpX chaperone zinc binding domain [103608] (2 proteins)
  6. 3036062Protein automated matches [190269] (1 species)
    not a true protein
  7. 3036063Species Escherichia coli [TaxId:562] [187059] (4 PDB entries)
  8. 3036065Domain d2ds5b_: 2ds5 B: [131682]
    automated match to d1ovxa_
    complexed with ca, pg4, zn

Details for d2ds5b_

PDB Entry: 2ds5 (more details), 1.5 Å

PDB Description: Structure of the ZBD in the orthorhomibic crystal from
PDB Compounds: (B:) ATP-dependent Clp protease ATP-binding subunit clpX

SCOPe Domain Sequences for d2ds5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ds5b_ g.39.1.11 (B:) automated matches {Escherichia coli [TaxId: 562]}
sgkllycsfcgksqhevrkliagpsvyicdecvdlcndiireei

SCOPe Domain Coordinates for d2ds5b_:

Click to download the PDB-style file with coordinates for d2ds5b_.
(The format of our PDB-style files is described here.)

Timeline for d2ds5b_: