Lineage for d2ds5a1 (2ds5 A:11-48)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750588Family g.39.1.11: ClpX chaperone zinc binding domain [103608] (1 protein)
  6. 750589Protein ClpX chaperone zinc binding domain [103609] (1 species)
  7. 750590Species Escherichia coli [TaxId:562] [103610] (4 PDB entries)
  8. 750591Domain d2ds5a1: 2ds5 A:11-48 [131681]
    automatically matched to d1ovxa_
    complexed with ca, pg4, zn

Details for d2ds5a1

PDB Entry: 2ds5 (more details), 1.5 Å

PDB Description: Structure of the ZBD in the orthorhomibic crystal from
PDB Compounds: (A:) ATP-dependent Clp protease ATP-binding subunit clpX

SCOP Domain Sequences for d2ds5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ds5a1 g.39.1.11 (A:11-48) ClpX chaperone zinc binding domain {Escherichia coli [TaxId: 562]}
llycsfcgksqhevrkliagpsvyicdecvdlcndiir

SCOP Domain Coordinates for d2ds5a1:

Click to download the PDB-style file with coordinates for d2ds5a1.
(The format of our PDB-style files is described here.)

Timeline for d2ds5a1: