Lineage for d2drna1 (2drn A:2-46)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322371Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 2322372Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) (S)
    dimer of identical alpha-hairpin motifs
  5. 2322373Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)
  6. 2322381Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species)
  7. 2322382Species Mouse (Mus musculus) [TaxId:10090] [47394] (4 PDB entries)
  8. 2322385Domain d2drna1: 2drn A:2-46 [131672]
    Other proteins in same PDB: d2drna2, d2drnb2
    automatically matched to d1l6ea_

Details for d2drna1

PDB Entry: 2drn (more details)

PDB Description: docking and dimerization domain (d/d) of the type ii-alpha regulatory subunity of protein kinase a (pka) in complex with a peptide from an a-kinase anchoring protein
PDB Compounds: (A:) cAMP-dependent protein kinase type II-alpha regulatory subunit

SCOPe Domain Sequences for d2drna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2drna1 a.31.1.1 (A:2-46) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]}
mghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr

SCOPe Domain Coordinates for d2drna1:

Click to download the PDB-style file with coordinates for d2drna1.
(The format of our PDB-style files is described here.)

Timeline for d2drna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2drna2