Lineage for d2drba3 (2drb A:258-437)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196795Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) (S)
  5. 2196811Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (2 proteins)
    decorated fold with a large insertion
  6. 2196812Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species)
  7. 2196813Species Archaeoglobus fulgidus [TaxId:2234] [102997] (26 PDB entries)
    Uniprot O28126
  8. 2196836Domain d2drba3: 2drb A:258-437 [131671]
    Other proteins in same PDB: d2drba1, d2drba2
    automated match to d1r89a3
    protein/RNA complex; complexed with so4

Details for d2drba3

PDB Entry: 2drb (more details), 2.8 Å

PDB Description: Complex structure of CCA-adding enzyme with tRNAminiCCA
PDB Compounds: (A:) CCA-adding enzyme

SCOPe Domain Sequences for d2drba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2drba3 d.58.16.2 (A:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr
safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf
emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd

SCOPe Domain Coordinates for d2drba3:

Click to download the PDB-style file with coordinates for d2drba3.
(The format of our PDB-style files is described here.)

Timeline for d2drba3: