Lineage for d2drba2 (2drb A:1-142)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740075Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 740076Superfamily d.218.1: Nucleotidyltransferase [81301] (11 families) (S)
  5. 740290Family d.218.1.7: Archaeal tRNA CCA-adding enzyme catalytic domain [102940] (1 protein)
    similar overall structure to poly(A) polymerase, PAP
  6. 740291Protein tRNA nucleotidyltransferase, N-terminal domain [102941] (1 species)
  7. 740292Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102942] (17 PDB entries)
  8. 740309Domain d2drba2: 2drb A:1-142 [131670]
    Other proteins in same PDB: d2drba1, d2drba3
    automatically matched to d1r89a2
    complexed with so4

Details for d2drba2

PDB Entry: 2drb (more details), 2.8 Å

PDB Description: Complex structure of CCA-adding enzyme with tRNAminiCCA
PDB Compounds: (A:) CCA-adding enzyme

SCOP Domain Sequences for d2drba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2drba2 d.218.1.7 (A:1-142) tRNA nucleotidyltransferase, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
kniksavdrtpfhhkwlegrik

SCOP Domain Coordinates for d2drba2:

Click to download the PDB-style file with coordinates for d2drba2.
(The format of our PDB-style files is described here.)

Timeline for d2drba2: