Lineage for d2dr7a3 (2dr7 A:258-437)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863067Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (2 families) (S)
  5. 863083Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (1 protein)
    decorated fold with a large insertion
  6. 863084Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species)
  7. 863085Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102997] (28 PDB entries)
    Uniprot O28126
  8. 863106Domain d2dr7a3: 2dr7 A:258-437 [131659]
    Other proteins in same PDB: d2dr7a1, d2dr7a2
    automatically matched to d1r89a3
    complexed with so4

Details for d2dr7a3

PDB Entry: 2dr7 (more details), 2.8 Å

PDB Description: Complex structure of CCA-adding enzyme with tRNAminiDC
PDB Compounds: (A:) CCA-adding enzyme

SCOP Domain Sequences for d2dr7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dr7a3 d.58.16.2 (A:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr
safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf
emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd

SCOP Domain Coordinates for d2dr7a3:

Click to download the PDB-style file with coordinates for d2dr7a3.
(The format of our PDB-style files is described here.)

Timeline for d2dr7a3: