Lineage for d2dqzc_ (2dqz C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2150570Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2150837Protein automated matches [190065] (6 species)
    not a true protein
  7. 2150843Species Human (Homo sapiens) [TaxId:9606] [186857] (44 PDB entries)
  8. 2150886Domain d2dqzc_: 2dqz C: [131649]
    automated match to d1k4ya_
    complexed with coa, f, htq, nag, plm, sia, so4

Details for d2dqzc_

PDB Entry: 2dqz (more details), 2.8 Å

PDB Description: crystal structure of human carboxylesterase in complex with homatropine, coenzyme a, and palmitate
PDB Compounds: (C:) Liver carboxylesterase 1

SCOPe Domain Sequences for d2dqzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dqzc_ c.69.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak

SCOPe Domain Coordinates for d2dqzc_:

Click to download the PDB-style file with coordinates for d2dqzc_.
(The format of our PDB-style files is described here.)

Timeline for d2dqzc_: