![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins) automatically mapped to Pfam PF00135 |
![]() | Protein automated matches [190065] (7 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186857] (44 PDB entries) |
![]() | Domain d2dqyc_: 2dqy C: [131646] automated match to d1k4ya_ complexed with chd, nag, plm, sia, so4 |
PDB Entry: 2dqy (more details), 3 Å
SCOPe Domain Sequences for d2dqyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dqyc_ c.69.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
Timeline for d2dqyc_: