Lineage for d2dqnc1 (2dqn C:3-100)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778337Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 778499Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family) (S)
  5. 778500Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein)
    Pfam PF02686
  6. 778501Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (1 species)
  7. 778502Species Staphylococcus aureus [TaxId:1280] [141003] (5 PDB entries)
    Uniprot P68807 2-100
  8. 778505Domain d2dqnc1: 2dqn C:3-100 [131642]
    Other proteins in same PDB: d2dqna1, d2dqnb1, d2dqnb2
    automatically matched to 2DF4 C:2-100
    complexed with asn, mg

Details for d2dqnc1

PDB Entry: 2dqn (more details), 2.55 Å

PDB Description: structure of trna-dependent amidotransferase gatcab complexed with asn
PDB Compounds: (C:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

SCOP Domain Sequences for d2dqnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dqnc1 a.137.12.1 (C:3-100) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]}
kvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqnv
lredkaikgipqelalknaketedgqfkvptimneeda

SCOP Domain Coordinates for d2dqnc1:

Click to download the PDB-style file with coordinates for d2dqnc1.
(The format of our PDB-style files is described here.)

Timeline for d2dqnc1: