SCOPe 2.08: Domain d2dqnc_: 2dqn C:

Lineage for d2dqnc_ (2dqn C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family)

5. Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein)
   Pfam PF02686

6. Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [141003] (5 PDB entries)
   Uniprot P68807 2-100

8. Domain d2dqnc_: 2dqn C: [131642]
   Other proteins in same PDB: d2dqna_, d2dqnb1, d2dqnb2
   automated match to d2df4c1
   protein/RNA complex; complexed with asn, mg

Details for d2dqnc_

PDB Entry: 2dqn, 2.55 Å

PDB Description: structure of trna-dependent amidotransferase gatcab complexed with asn

PDB Compounds: (C:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

SCOPe Domain Sequences for d2dqnc_:

Sequence; same for both SEQRES and ATOM records:

>d2dqnc_ a.137.12.1 (C:) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]}
kvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqnv
lredkaikgipqelalknaketedgqfkvptimneeda

Timeline for d2dqnc_:

• d2dqnc_ first appeared in SCOP 1.73, called d2dqnc1
  
• d2dqnc_ appears in SCOPe 2.07