Lineage for d2dqnb2 (2dqn B:3-293)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040112Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1040113Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families) (S)
  5. 1040316Family d.128.1.5: GatB/GatE catalytic domain-like [143812] (2 proteins)
    N-terminal and C-terminal parts correspond to Pfam PF02934 (GatB_N) and Pfam PF01162 (GatB), respectively
  6. 1040317Protein Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, N-terminal domain [143813] (1 species)
  7. 1040318Species Staphylococcus aureus [TaxId:1280] [143814] (5 PDB entries)
    Uniprot P64201 2-293
  8. 1040321Domain d2dqnb2: 2dqn B:3-293 [131641]
    Other proteins in same PDB: d2dqna_, d2dqnb1, d2dqnc_
    automatically matched to 2DF4 B:2-293
    protein/RNA complex; complexed with asn, mg

Details for d2dqnb2

PDB Entry: 2dqn (more details), 2.55 Å

PDB Description: structure of trna-dependent amidotransferase gatcab complexed with asn
PDB Compounds: (B:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B

SCOPe Domain Sequences for d2dqnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dqnb2 d.128.1.5 (B:3-293) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
fetviglevhvelktdskmfspspahfgaepnsntnvidlaypgvlpvvnkravdwamra
amalnmeiateskfdrknyfypdnpkayqisqfdqpigengyidievdgetkrigitrlh
meedagksthkgeyslvdlnrqgtplieivsepdirspkeayayleklrsiiqytgvsdv
kmeegslrcdanislrpygqekfgtkaelknlnsfnyvrkgleyeekrqeeellnggeig
qetrrfdestgktilmrvkegsddyryfpepdivplyiddawkervrqtip

SCOPe Domain Coordinates for d2dqnb2:

Click to download the PDB-style file with coordinates for d2dqnb2.
(The format of our PDB-style files is described here.)

Timeline for d2dqnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dqnb1