SCOPe 2.08: Domain d2dqnb1: 2dqn B:294-407

Lineage for d2dqnb1 (2dqn B:294-407)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.182: GatB/YqeY motif [89094] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles (4-helical and 3-helical)

4. Superfamily a.182.1: GatB/YqeY motif [89095] (2 families)

5. Family a.182.1.2: GatB/GatE C-terminal domain-like [140757] (2 proteins)
   assigned to the same Pfam PF02637 family as YeqY by the presence of a common sequence motif with an alpha-hairpin structure

6. Protein Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, C-terminal domain [140758] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [140759] (5 PDB entries)
   Uniprot P64201 294-400

8. Domain d2dqnb1: 2dqn B:294-407 [131640]
   Other proteins in same PDB: d2dqna_, d2dqnb2, d2dqnc_
   automated match to d2df4b1
   protein/RNA complex; complexed with asn, mg
   has additional insertions and/or extensions that are not grouped together

Details for d2dqnb1

PDB Entry: 2dqn, 2.55 Å

PDB Description: structure of trna-dependent amidotransferase gatcab complexed with asn

PDB Compounds: (B:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B

SCOPe Domain Sequences for d2dqnb1:

Sequence; same for both SEQRES and ATOM records:

>d2dqnb1 a.182.1.2 (B:294-407) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
elpderkakyvnelglpaydahvltltkemsdffestiehgadvkltsnwlmggvneyln
knqvelldtkltpenlagmikliedgtmsskiakkvfpelaakggnakqimedn

Timeline for d2dqnb1:

• d2dqnb1 first appeared in SCOP 1.73
  
• d2dqnb1 appears in SCOPe 2.07