Lineage for d2dqjh_ (2dqj H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740618Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (32 PDB entries)
  8. 2740628Domain d2dqjh_: 2dqj H: [131635]
    Other proteins in same PDB: d2dqjl_, d2dqjy_
    automated match to d1c08b_

Details for d2dqjh_

PDB Entry: 2dqj (more details), 1.8 Å

PDB Description: Crystal structure of hyhel-10 FV (wild-type) complexed with hen egg lysozyme at 1.8A resolution
PDB Compounds: (H:) Ig VH,anti-lysozyme

SCOPe Domain Sequences for d2dqjh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dqjh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

SCOPe Domain Coordinates for d2dqjh_:

Click to download the PDB-style file with coordinates for d2dqjh_.
(The format of our PDB-style files is described here.)

Timeline for d2dqjh_: