Lineage for d2dqih_ (2dqi H:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (32 PDB entries)
  8. Domain d2dqih_: 2dqi H: [131633]
    Other proteins in same PDB: d2dqil1, d2dqiy_
    automated match to d1c08b_
    mutant

Details for d2dqih_

PDB Entry: 2dqi (more details), 2 Å

PDB Description: Crystal structure of hyhel-10 FV mutant (Ly50a) complexed with hen egg lysozyme
PDB Compounds: (H:) Ig VH,anti-lysozyme

SCOPe Domain Sequences for d2dqih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dqih_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

SCOPe Domain Coordinates for d2dqih_ are not available.

Timeline for d2dqih_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dqil1, d2dqiy_