SCOP 1.73: Domain d2dqfd1: 2dqf D:1-107

Lineage for d2dqfd1 (2dqf D:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d2dqfd1: 2dqf D:1-107 [131627]
   Other proteins in same PDB: d2dqfc1, d2dqff1
   automatically matched to d3hfml1
   mutant

Details for d2dqfd1

PDB Entry: 2dqf, 2.5 Å

PDB Description: Crystal structure of hyhel-10 FV mutant (y33ay53a) complexed with hen egg lysozyme

PDB Compounds: (D:) lysozyme binding Ig kappa chain V23-J2 region

SCOP Domain Sequences for d2dqfd1:

Sequence; same for both SEQRES and ATOM records:

>d2dqfd1 b.1.1.1 (D:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

Timeline for d2dqfd1:

• d2dqfd1 is new in SCOP 1.73
  
• d2dqfd1 appears in SCOP 1.75
  
• d2dqfd1 appears in the current release, SCOPe 2.08, called d2dqfd_