SCOP 1.73: Domain d2dpza1: 2dpz A:1-133

Lineage for d2dpza1 (2dpz A:1-133)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (47 PDB entries)

8. Domain d2dpza1: 2dpz A:1-133 [131618]
   automatically matched to d1cl5a_
   complexed with so4, tyl

Details for d2dpza1

PDB Entry: 2dpz, 2.1 Å

PDB Description: structure of the complex of phospholipase a2 with n-(4-hydroxyphenyl)- acetamide at 2.1 a resolution

PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOP Domain Sequences for d2dpza1:

Sequence; same for both SEQRES and ATOM records:

>d2dpza1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d2dpza1:

• d2dpza1 is new in SCOP 1.73
  
• d2dpza1 appears in SCOP 1.75
  
• d2dpza1 appears in the current release, SCOPe 2.08, called d2dpza_