Lineage for d2dpua1 (2dpu A:8-122)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1079364Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1079549Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein)
  6. 1079550Protein Replication terminator protein (RTP) [46808] (1 species)
    contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer
  7. 1079551Species Bacillus subtilis [TaxId:1423] [46809] (6 PDB entries)
  8. 1079562Domain d2dpua1: 2dpu A:8-122 [131617]
    automatically matched to d1j0rb_
    protein/DNA complex

Details for d2dpua1

PDB Entry: 2dpu (more details), 3.1 Å

PDB Description: crystal structure of the replication termination protein in complex with a pseudosymmetric 21mer b-site dna
PDB Compounds: (A:) Replication termination protein

SCOPe Domain Sequences for d2dpua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dpua1 a.4.5.7 (A:8-122) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
stgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhelldd
gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf

SCOPe Domain Coordinates for d2dpua1:

Click to download the PDB-style file with coordinates for d2dpua1.
(The format of our PDB-style files is described here.)

Timeline for d2dpua1: