Lineage for d2dpia2 (2dpi A:26-299)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2623694Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 2623772Protein DNA polymerase iota [111295] (1 species)
  7. 2623773Species Human (Homo sapiens) [TaxId:9606] [111296] (19 PDB entries)
    Uniprot Q9UNA4
  8. 2623777Domain d2dpia2: 2dpi A:26-299 [131613]
    Other proteins in same PDB: d2dpia1
    protein/DNA complex; complexed with dcp, mg

Details for d2dpia2

PDB Entry: 2dpi (more details), 2.3 Å

PDB Description: Ternary complex of hPoli with DNA and dCTP
PDB Compounds: (A:) DNA polymerase iota

SCOPe Domain Sequences for d2dpia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dpia2 e.8.1.7 (A:26-299) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
ssrvivhvdldcfyaqvemisnpelkdkplgvqqkylvvtcnyearklgvkklmnvrdak
ekcpqlvlvngedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlqs
delsavtvsghvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnkll
aklvsgvfkpnqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtfs
pkilekelgisvaqriqklsfgednspvilsgpp

SCOPe Domain Coordinates for d2dpia2:

Click to download the PDB-style file with coordinates for d2dpia2.
(The format of our PDB-style files is described here.)

Timeline for d2dpia2: