SCOPe 2.07: Domain d2dpdb_: 2dpd B:

Lineage for d2dpdb_ (2dpd B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein)
   automatically mapped to Pfam PF02334

6. Protein Replication terminator protein (RTP) [46808] (1 species)
   contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer

7. Species Bacillus subtilis [TaxId:1423] [46809] (7 PDB entries)

8. Domain d2dpdb_: 2dpd B: [131611]
   automated match to d1bm9a_
   protein/DNA complex

Details for d2dpdb_

PDB Entry: 2dpd, 3.17 Å

PDB Description: crystal structure of the replication termination protein in complex with a pseudosymmetric b-site

PDB Compounds: (B:) Replication termination protein

SCOPe Domain Sequences for d2dpdb_:

Sequence; same for both SEQRES and ATOM records:

>d2dpdb_ a.4.5.7 (B:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
rsstgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhell
ddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf

Timeline for d2dpdb_:

• d2dpdb_ first appeared in SCOP 1.73, called d2dpdb1
  
• d2dpdb_ appears in SCOPe 2.06
  
• d2dpdb_ appears in the current release, SCOPe 2.08