Lineage for d2dpda1 (2dpd A:8-122)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635064Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein)
  6. 635065Protein Replication terminator protein (RTP) [46808] (1 species)
    contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer
  7. 635066Species Bacillus subtilis [TaxId:1423] [46809] (5 PDB entries)
  8. 635074Domain d2dpda1: 2dpd A:8-122 [131610]
    automatically matched to d1j0rb_
    mutant

Details for d2dpda1

PDB Entry: 2dpd (more details), 3.17 Å

PDB Description: crystal structure of the replication termination protein in complex with a pseudosymmetric b-site
PDB Compounds: (A:) Replication termination protein

SCOP Domain Sequences for d2dpda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dpda1 a.4.5.7 (A:8-122) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
stgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhelldd
gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf

SCOP Domain Coordinates for d2dpda1:

Click to download the PDB-style file with coordinates for d2dpda1.
(The format of our PDB-style files is described here.)

Timeline for d2dpda1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dpdb1